Prdx1, 1-199aa, Mouse, His tag, Baculovirus (Bioactivity Validated)

Categories: [Proteins / Peptides]
Prdx1, also known as peroxiredoxin-1, is an important member of peroxiredoxins (Prdxs) regulating various cellular signaling and differentiation. It confers an aggressive survival phenotype of cancer cells and drug-resistance. This protein is also identified as a red blood cell factor which enhances natural killer (NK) cell activity. Recombinant mouse Prdx1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $154
  • Buy 5 for $146.3 each and save 5%
  • Buy 21 for $138.6 each and save 10%
  • Buy 31 for $130.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03513
Size 10 µg
Host Baculovirus
Accession
Molecular Weight 23.2kDa (207aa), 18-28KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences MSSGNAKIGYPAPNFKATAVMPDGQFKDISLSEYKGKYVVFFFYPLDFTFVCPTEIIAFSDRADEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLISDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEIIRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQKLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Peroxiredoxin-1, Prdx1, MSP23, NkefA, OSF-3, OSF3, PAG, Paga, Prdx I, prdx1, Prx I, Tdpx2, TDX2, TPxA
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap