PPP1R11, 1-126aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Protein phosphatase 1 regulatory subunit 11, also known as PPP1R11, is a 126 amino acid protein that is expressed in a variety of both adult and fetal tissues. PPP1R11 functions as an inhibitor of PP1 (protein phosphatase 1), specifically exhibiting a sensitivity toward the metal-independent and metal-dependent forms of PP1. Deletion of a portion of the q arm of chromosome 6 is associated with early onset intestinal cancer, suggesting the presence of a cancer susceptibility locus. Recombinant human PPP1R11 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03501
Size 50 µg
Host E.coli
Accession
Molecular Weight 16.3kDa (149aa), confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAEAGAGLSETVTETTVTVTTEPENRSLTIKLRKRKPEKKVEWTSDTVDNEHMGRRSSKCCCIYEKPRAFGESSTESDEEEEEGCGHTHCVRGHRKGRRRATLGPTPTTPPQPPDPSQPPPGPMQH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 20% glycerol, 1mM DTT
Other Names Protein phosphatase 1 regulatory subunit 11, HCG-V, HCGV, IPP3, TCTE5, TCTEX5
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap