PPP1CA, 1-330aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PPP1CA, also known as serine/threonine-protein phosphatase PP1-alpha catalytic subunit, is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. This protein may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II. Recombinant human PPP1CA protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03499
Size 10 µg
Host E.coli
Accession
Molecular Weight 39.7 kDa (350aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSDSEKLNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPADKNKGKYGQFSGLNPGGRPITPPRNSAKAKK
Purity > 95% by HPLC
Concentration 0.2 mg/ml (determined by Bradford assay)
Formulation Liquid. 50mM Tris-HCl (pH8.5),0.2M NaCl, 1mM DTT, 0.1mM PMSF, 1mM MnCl2, 50%glycerol.
Other Names Serine/threonine-protein phosphatase PP1-alpha catalytic subunit, PP-1A, PP1alpha, PPP1A.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap