Home / Products / proteins / PPM1G, 317-546 aa, Human, His-tagged, Recombinant, E.coli

PPM1G, 317-546 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
PPM1G (Protein phosphatase 1G) is a member of the PP2C family of Serine/threonine protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. The human Ser/Thr phosphatase PPM1G promotes spliceosome assembly. This phosphatase is found to be responsible for the dephosphorylation of Pre-mRNA splicing factors, which is important for the formation of functional spliceosome.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03497
Size 100 µg
Host E.coli
Accession
Molecular Weight 27 kDa (250 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMEGKEEPGSDSGTTAVVALIRGKQLIVANAGDSRCVVSEAGKALDMSYDHKPEDEVELARIKNAGGKVTMDGRVNGGLNLSRAIGDHFYKRNKNLPPEEQMISALPDIKVLTLTDDHEFMVIACDGIWNVMSSQEVVDFIQSKISQRDENGELRLLSSIVEELLDQCLAPDTSGDGTGCDNMTCIIICFKPRNTAELQPESGKRKLEEVLSTEGAEENGNSDKKKKAKRD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 25 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT 2 mM EDTA, 2 mM β-mercaptoethanol, 20% glycerol
Other Names Protein phosphatase 1G, PP2CG, PPP2CG, PP2CGAMMA.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap