Home / Products / proteins / PPIL3, 1-161aa, Human, His tag, E.coli

PPIL3, 1-161aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PPIL3, also known as peptidyl-prolyl cis-trans isomerase-like 3, is a member of the cyclophilin family that catalyzes the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. It has been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Recombinant human PPIL3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03492
Size 100 µg
Host E.coli
Accession
Molecular Weight 20.3 kDa (181aa), confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Peptidyl-prolyl cis-trans isomerase-like 3 isoform PPIL3b, CYPJ.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap