Home / Products / proteins / PPIE, 1-301aa, Human,His-Tagged, Recombinant, E.coli

PPIE, 1-301aa, Human,His-Tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Cyclophilins possess the activity of peptidyl-prolyl cis-trans isomerase (PPIase) and are involved in cellular protein folding and protein interactions. PPIE contains two RNA binding domains at the N-terminal region and a PPIase domain at the C-terminal region. It was not known what cellular and physiological roles of PPIE. Recombinant human PPIE was expressed in E.coli and purified by conventional chromatography techniques.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03488
Size 100 µg
Host E.coli
Accession
Molecular Weight 37.5 kDa (337 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMATTKRVLYVGGLAEEVDDKVLHAAFIPFGDITDIQIPLDYETEKHRGFAFVEFELAEDAAAAIDNMNESELFGRTIRVNLAKPMRIKEGSSRPVWSDDDWLKKFSGKTLEENKEEEGSEPPKAETQEGEPIAKKARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHEKGFGFKGSSFHRIIPQFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLDGKHVVFGEVTEGLDVLRQIEAQGSKDGKPKQKVIIADCGEYV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0)
Other Names Peptidylprolyl isomerase E isoform 1, CYP-33, Cyclophilin E, PPIase E, Rotamase E.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap