Home / Products / proteins / PPBP, 35-128aa, Human, E.coli

PPBP, 35-128aa, Human, E.coli

Categories: [Proteins / Peptides]
PPBP, also known as chemokine (C-X-C motif) ligand 7 (CXCL7), is a platelet-derived growth factor that belongs to the alpha-chemokine family, It is a protein that is released in large amounts from platelets following their activation. It stimulates various processes including mitogenesis, synthesis of extracellular matrix, glucose metabolism and synthesis of plasminogen activator.
List Price: $500
  • Buy 5 for $475 each and save 5%
  • Buy 21 for $450 each and save 10%
  • Buy 31 for $425 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03482
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.3 kDa (95aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MSSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. In. 20mM Tris-HCl buffer (pH7.5) containing 10% glycerol 1mM DTT
Other Names Pro-platelet basic protein, B-TG1, Beta-TG, CTAP3, CXCL7; LA-PF4, LDGF, MDGF, NAP-2, PBP, SCYB7, TC1, TGB, THBGB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap