Home / Products / proteins / PPARG, 209-477aa, Human, His tag, E.coli

PPARG, 209-477aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PPARG, also known as Peroxisome proliferator-activated receptor gamma, is member of the nuclear hormone receptor subfamily of transcription factors. This protein regulates transcription of genes involved in Insulin action, adipocyte differentiation, lipid metabolism and inflammation. It is implicated in numerous diseases including obesity, diabetes, atherosclerosis and cancer.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03481
Size 100 µg
Host E.coli
Accession
Molecular Weight 33.0kDa (290aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol 0.1M NaCl
Other Names Peroxisome proliferator-activated receptor gamma, NR1C3, CIMT1, GLM1, NR1C3, PPARG1, PPARG2, PPARgamma.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap