Home / Products / proteins / POU2AF1, 1-256aa, Human, His tag, E.coli

POU2AF1, 1-256aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
POU2AF1, also known as BOB1, is a lymphocyte specific transcription coactivator protein. This protein interacts only with the Oct1/2 proteins through sub domains in the POU domain of the Oct1/2 proteins, enhancing their transcriptional efficacy. Although having no intrinsic capacity for DNA binding, POU2AF1 associates tightly with the octomer motif in the presence of Oct1 and Oct2. POU2AF1 is expressed at highest levels in spleen and peripheral blood leukocytes.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03476
Size 50 µg
Host E.coli
Accession
Molecular Weight 29.6 kDa (276aa), confirmed by MALDI-TOF (molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol
Other Names POU domain class 2-associating factor 1, BOB1, OBF-1, OBF1, OCAB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap