Home / Products / proteins / POLR2J3, 1-115aa, Human, His tag, E.coli

POLR2J3, 1-115aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DNA-directed RNA polymerase II subunit RPB11-b2, also known as POLR2J3, belongs to the eukaryotic RPB11 RNA polymerase subunit family. POLR2J (DNA-directed RNA polymerase II subunit J) exist as three variants POLR2J1 (RPB11-a), POLR2J2 (RPB11-b1), and POLR2J3 (RPB11-b2). POLR2J3 is DNAdependent RNA polymerases that catalyze the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03466
Size 50 µg
Host E.coli
Accession
Molecular Weight 15.5 kDa (138aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNAPPAFESFLLFEGEKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRTCLLPLRLLP
Purity > 95% by HPLC
Concentration 0.5 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 40% glycerol,1mM DTT
Other Names DNA-directed RNA polymerase II subunit RPB11-b2, POLR2J2, RPB11b1, RPB11b2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap