Home / Products / proteins / POLR2J,1-117aa, Human, His tag, E.coli

POLR2J,1-117aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
POLR2J is a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This protein exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03464
Size 50 µg
Host E.coli
Accession
Molecular Weight 15.7 kDa (140aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Purity > 95% by HPLC
Concentration 0.5 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 40% glycerol, 5mM DTT, and 2mM EDTA
Other Names DNA-directed RNA polymerase II subunit RPB11-a, hRPB14, POLR2J1, RPB11, RPB11A, RPB11m.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap