POFUT1, 27-388aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
GDP-fucose protein O-fucosyltransferase 1, also known as POUFUT1, is a member of the glycosyltransferase O-Fuc family. Highly expressed in pancreas, kidney, lung, heart, brain, liver, placenta and skeletal muscle, POFUT1 uses manganese to catalyze the attachment of fucose to a conserved serine or threonine residue on a protein accept. POFUT1 plays an important role in Notch signaling, as Notch ligands can serve as POFUT1 substrates. Recombinant human POFUT1 protein, fused to His-tag at N-terminus, was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03451
Size 100 µg
Host E.coli
Accession
Molecular Weight 43.7kDa (385aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSGSWDPAGYLLYCPCMGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAYHRVISLEDFMEKLAPTHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVSFNKSELFTGISFSASYREQWSQRFSPKEHPVLALPGAPAQFPVLEEHRPLQKYMVWSDEMVKTGEAQIHAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAAPLTMTMCLPDLKEIQRAVKLWVRSLDAQSVYVATDSESYVPELQQLFKGKVKVVSLKPEVAQVDLYILGQADHFIGNCVSSFTAFVKRERDLQGRPSSFFGMDRPPKLRDEF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2M Urea, 10% glycerol
Other Names GDP-fucose protein O-fucosyltransferase 1, FUT12, O-Fuc-T, O-FucT-1, O-FUT
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap