Home / Products / proteins / PMVK, 1-192aa, Human, His tag, E.coli

PMVK, 1-192aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Phosphomevalonate kinase, also known as PMVK, is a cytosolic enzyme. It was expressed highly in heart, liver, skeletal muscle, kidney and pancreas and slightly lower in brain, placenta, and lung. Induced by sterol, PMVK participates in isopentenyl diphosphate biosynthesis via the mevalonate pathway. PMVK catalyzes the conversion of mevalonate 5-phosphate into mevalonate 5-diphosphate in the fifth reaction of the cholesterol biosynthetic pathway.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03444
Size 100 µg
Host E.coli
Accession
Molecular Weight 24.1 kDa (212aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 1mM DTT, 10% glycerol, 0.1M NaCl
Other Names Phosphomevalonate kinase, HUMPMKI, PMK, PMKA, PMKASE.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap