Home / Products / proteins / PMP2, 1-132aa, Human, Recombinant, E.coli

PMP2, 1-132aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
PMP2 (Peripheral myelin protein 2) is a small basic protein found in peripheral nerve myelin and spinal cord myelin, belongs to a family of fatty acid binding proteins. PMP2 partly decreases the inhibitory effect of T suppressors in the culture of immune lymph node cells. Recombinant PMP2 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03443
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.9 kDa (132 aa)
AP_Mol_Weight
Tag
Sequences MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid in 20mM Tris pH 7.5, 2mM EDTA, 1mM DTT, 10% glycerol
Other Names Peripheral myelin protein 2, P2, MP2, FABP8, M-FABP.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap