PLAUR, 23-305aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
PLAUR, as known as urokinase plasminogen activator surface receptor isoform 1, is one of two activators that converts the extracellular zymogen plasminogen to plasmin, a serine protease that is involved in a variety of normal and pathological processes that require cell migration and/or tissue destruction. This protein is synthesized and released from cells as a single-chain proenzyme with limited enzymatic activity and is converted to an active two-chain disulfide-linked active enzyme by plasmin and other specific proteinases. Recombinant human PLAUR, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03433
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 32.5kDa (291aa), 40-57kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names Urokinase plasminogen activator surface receptor isoform 1 , PLAUR, CD87, U-PAR, UPAR, URKR, CD 87, CD87CD87 antigen, MO 3, MO3, Monocyte activation antigen Mo3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap