Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP03409 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 18.2 kDa (163aa), confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | |
Sequences | MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 100 mM NaCl, 5 mM DTT, 20% glycerol. |
Other Names | Protein (peptidyl-prolyl cis/trans isomerase) NIMA-interacting 1, NIMA-interacting protein 1, DOD, UBL5, Rotamase Pin1, PPIase Pin1. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap