Home / Products / proteins / PHPT1, 1-125aa, Human, His tag, E.coli

PHPT1, 1-125aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PHPT1 is a 125 amino acid enzyme belonging to the Janus protein family. Existing as a monomer in the cytoplasm, PHPT1 is an EDTA-insensitive phosphohistidine phosphatase. Overexpression of PHPT1 leads to specific phosphohistidine phosphatase activity towards phosphopeptide I, with no activity detected towards phosphotyrosine, phosphothreonine and phosphoserine peptides.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03399
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.9 kDa (145aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Other Names 14 kDa phosphohistidine phosphatase, bA216L13.10, CGI-202, DKFZp564M173, HSPC141, PHP14, RP11-216L13.10.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap