Home / Products / proteins / PHPT1, 1-125aa, Human, His-tag, E.coli (Bioactivity Validated)

PHPT1, 1-125aa, Human, His-tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
PHPT1 is a 125 amino acid enzyme belonging to the Janus protein family. Existing as a monomer in the cytoplasm, PHPT1 is an EDTA-insensitive phosphohistidine phosphatase. Overexpression of PHPT1 leads to specific phosphohistidine phosphatase activity towards phosphopeptide I, with no activity detected towards phosphotyrosine, phosphothreonine and phosphoserine peptides. Recombinant human PHPT1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $131
  • Buy 5 for $124.45 each and save 5%
  • Buy 21 for $117.9 each and save 10%
  • Buy 31 for $111.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03400
Size 20 µg
Host E.coli
Accession
Molecular Weight 15.9 kDa (145aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Other Names 14 kDa phosphohistidine phosphatas, bA216L13.10, CGI-202, DKFZp564M173, HSPC141, PHP14, RP11-216L13.10
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap