Home / Products / proteins / PHLDA2, 1-152aa, Human, His tag, E.coli

PHLDA2, 1-152aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PHLDA2, also known as Pleckstrin homology-like domain family A member 2, is a cytoplasmic protein that is involved in fetal and placental growth. It is an apoptosis-related protein that acts as a negative growth regulator and is expressed during normal human development. This protein is imprinted on placenta, liver and fetal tissues during embryogenesis and is removed once development is complete.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03395
Size 50 µg
Host E.coli
Accession
Molecular Weight 19.2 kDa (172aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Pleckstrin homology-like domain family A member 2, BRW1C, BWR1C, HLDA2, IPL, TSSC3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap