Home / Products / proteins / PFN2, 1-140 aa, Human, His-tagged, Recombinant, E.coli

PFN2, 1-140 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
PFN2 is a ubiquitous actin monomer-binding protein belonging to the profilin family. This protein is ubiquitously expressed with highest expression in kidney, brain and skeletal muscle. Like other members of the profilin family, PFN2 functions as an actin monomer-binding protein that influences the structure of the cytoskeleton by regulating actin polymerization in response to extracellular signals.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03367
Size 50 µg
Host E.coli
Accession
Molecular Weight 17.2 kDa (160aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 1mM DTT.
Other Names Profilin 2, PFL.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap