Pfn1, 1-140 aa, Rat, His tag, E.coli

Categories: [Proteins / Peptides]
Pfn1 also known as Profilin-1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. This protein significantly enhances skin wound healing in-vitro and in-vivo that may be mediated by purinergic receptors. It is also active in endothelial cell migration and vessel sprouting. It is thought to regulate actin polymerization in response to extracellular signals. Recombinant rat Pfn1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03366
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.5 kDa (164aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAGWNAYIDSLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVSITPAEVGVLVGKDRSSFFVNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNVTVTMTAKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline(pH 7.4) containing 10% glycerol 1mM DTT
Other Names
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap