Home / Products / proteins / PFDN4, 1-134aa, Human, His tag, E.coli

PFDN4, 1-134aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Prefoldin subunit 4, also known PFDN4, is a member of the prefoldin beta subunit family. PFDN4 is a heterohexameric chaperone protein which has the ability to capture unfolded actin and is a possible transcription factor. Six prefoldin polypeptides, prefoldin 1-6, have been identified. Recombinant human PFDN4 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03362
Size 50 µg
Host E.coli
Accession
Molecular Weight 17.4 kDa (154aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLADDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLYAKFGSNINLEADES
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 1mM DTT, 10% glycerol, 50mM NaCl
Other Names Prefoldin subunit 4, Protein C-1, PFD4.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap