Home / Products / proteins / PF4V1, 31-104aa, Human, His tag, E.coli

PF4V1, 31-104aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PF4V1 belongs to the intercrine alpha (chemokine CxC) family. It is a inhibitor of angiogenesis and inhibitor of endothelial cell chemotaxis(in vitro). Binding to heparin is much weaker than in the close homolog PF4/CXCL4. Recombinant human PF4V1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03359
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.6 kDa (97aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSFARAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 50% glycerol, 1mM DTT.
Other Names Platelet factor 4 variant, CXCL4L1, CXCL4V1, PF4-ALT, PF4A, SCYB4V1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap