Peroxiredoxin 5, 53-214 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Peroxiredoxin 5, also known as PRDX5, is a member of the peroxiredoxin family of antioxidant enzymes, which reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. This protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. It has been reported that peroxiredoxin 5 is involved in intracellular redox signaling.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03354
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.0 kDa (162aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MAPIKVGDAIPAVEVFEGEPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNIISQL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM HEPES buffer (pH 7.4).
Other Names ACR1, AOEB116, B116, PLP, PMP20, PRDX6, PRXV, SBBI10.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap