Pebp1, 1-187aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Pebp1 also known as Phosphatidylethanolamine-binding protein 1. The protein Binds with ATP, opioids and phosphatidylethanolamine. Pebp1 exerts inhibitory activity against several serine proteases including thrombin, neuropsin, and chymotrypsin, it also inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation. Also, targeting Pebp1 levels can delay photoreceptor degeneration, assisting in extending the time-window for treating such rapidly progressing blindness disorder. Recombinant mouse Pebp1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03343
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.2kDa (210aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRYVWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKLYEQLSGK
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH7.4) containing 10% glycerol
Other Names HCNP, Pbp, Pbp1, Pbqr, Rkip
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap