PEBP1, 1-187 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Phosphatidylethanolamine binding protein 1 (PEBP1), also known as Raf kinase inhibitor protein (RKIP), is a member of the phosphatidylethanolamine-binding protein family and a serine protease inhibitor which inhibits thrombin, neuropsin. PEBP1 plays a pivotal modulatory role in several protein kinase signaling cascades. Protein kinase C (PKC) phosphorylates PEBP1, resulting in release of Raf-1 and activation of MEK and ERK.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03342
Size 100 µg
Host E.coli
Accession
Molecular Weight 21 kDa (187aa)
AP_Mol_Weight
Tag
Sequences MPVDLSKWSGPLSLQEVDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKYREWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names Phosphatidylethanolamine binding protein 1, HCNP, PBP, PEBP.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap