Home / Products / proteins / PEA-15, 1-130 aa, Human, Recombinant, E.coli

PEA-15, 1-130 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Phospho-enriched protein in astrocytes 15 kDa (PEA-15) is a death effector domain (DED)-containing protein predominantly expressed in the central nervous system, particularly in astrocytes. This protein has been implicated in the regulation of multiple cellular processes including apoptosis, proliferation, glucose transport, adhesion and migration.
List Price: $731
  • Buy 5 for $694.45 each and save 5%
  • Buy 21 for $657.9 each and save 10%
  • Buy 31 for $621.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03341
Size 100 µg
Host E.coli
Accession
Molecular Weight 15 kDa (130aa)
AP_Mol_Weight
Tag
Sequences MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNLSYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKLAPPPKKA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT, 10% Glycerol
Other Names Phosphoprotein enriched in astrocytes, 15kD, Astrocytic phosphoprotein PEA-15, PEA15, PED.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap