PDRG1, 1-133aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PDRG1, also known as PDRG or C20orf126, is a 133 amino acid protein that localizes to the cytoplasm and belongs to the prefoldin subunit β family. Expressed predominately in normal testicular tissue, PDRG1 is functionally induced by ultraviolet light and is thought to play a role in chaperone-mediated protein folding, possibly playing a role in cellular degradation. It is associated with Creutzfeldt-Jakob disease, amyotrophic lateral sclerosis, spinal muscular atrophy, ring chromosome 20 epilepsy syndrome and Alagille syndrome.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03336
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.6 kDa (153aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLSPEAERVLRYLVEVEELAEEVLADKRQIVDLDTKRNQNREGLRALQKDLSLSEDVMVCFGNMFIKMPHPETKEMIEKDQDHLDKEIEKLRKQLKVKVNRLFEAQGKPELKGFNLNPLNQDELKALKVILKG
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 5mM DTT, 20% glycerol
Other Names p53 and DNA-damage regulated 1, C20orf126, PDRG.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap