Home / Products / proteins / PDPN, 99-207aa, Human, His-tagged, Recombinant, E.coli

PDPN, 99-207aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Podoplanin(PDPN) is a small mucin-like transmembrane protein, widely expressed in various specialized cell types throughout the body. This is a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03335
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.4 kDa (130 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 100 mM NaCl
Other Names Lung type-I cell membrane-associated glycoprotein isoform a, Podoplanin , T1A, GP36, GP40, Gp38, OTS8, T1A-2, HT1A-1, PA2.26.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap