Home / Products / proteins / PDK1, 29-436aa, Human, His-tagged, Recombinant, E.coli

PDK1, 29-436aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
PDK1 (pyruvate dehydrogenase kinase isoform 1) is involved in the regulation of enzymatic activity of mammalian pyruvate dehydrogenase (PDH) that is a part of a mitochondrial multienzyme complex to catalyze the oxidative decarboxylation of pyruvate and is one of the major enzymes responsible for the regulation of homeostasis of carbohydrate fuels in mammals. PDK1 has been found to serve as an effective therapeutic target for inhibition of glioblastoma growth.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03333
Size 100 µg
Host E.coli
Accession
Molecular Weight 48.6 kDa (429 aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMSSDSGSSPASERGVPGQVDFYARFSPSPLSMKQFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYFLDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLCDLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLPISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDWCVPSREPKDMTTFRSA
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.0) containing 100 mM NaCl, 0.5 mM DTT, 0.1 mM EDTA, 0.1 mM PMSF, 1 mM MgCl2, 40% glycerol
Other Names Pyruvate dehydrogenase kinase, isozyme 1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap