PDGFB, 82-190aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PDGFB, also known as, Platelet-derived growth factor subunit B isoform 2, is a member of Platelet derived growth factor (PDGF) family. In general, PDGF isoforms are potent mitogens for connective tissue cells, including dermal fibroblasts, glial cells, arterial smooth muscle cells and some epithelial and endothelial cells. In addition to its activity as a mitogen. Aberrant expression is involved in certain cancers, fibroproliferative disorders and atherosclerosis. Recombinant human PDGFB, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03323
Size 50 µg
Host E.coli
Accession
Molecular Weight 14.7kDa (130aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMCKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQRAKTPQ
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 10% glycerol
Other Names Platelet-derived growth factor subunit B isoform 2, c-sis, IBGC5, PDGF-2, PDGF2, SIS, SSV
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap