Home / Products / proteins / PDCD5, 1-125aa, Human, Recombinant, E.coli

PDCD5, 1-125aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
PDCD5 (Programmed cell death 5) encodes a protein expressed in tumor cells during apoptosis independent of the apoptosis-inducing stimuli. Prior to apoptosis induction, this gene product is distributed in both the nucleus and cytoplasm. The conformation of PDCD5 protein is a stable helical core consisting of a triple-helix bundle and two dissociated terminal regions.
List Price: $473
  • Buy 5 for $449.35 each and save 5%
  • Buy 21 for $425.7 each and save 10%
  • Buy 31 for $402.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03318
Size 100 µg
Host E.coli
Accession
Molecular Weight 14 kDa (125 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHRGAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKLNRRKVMDSDEDDDY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate-Buffered Saline (pH 7.4)
Other Names Programmed cell death 5, TFAR19.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap