PDAP1, 1-181aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PDGFA associated protein 1, also known as PDAP1, enhances PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB. And its expression is induced by TNF-alpha, and cells overexpressing PDAP1 show significantly less apoptosis on exposure to TNF-alpha. Recombinant human PDAP1 protein, fused to His-tag at C-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03314
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.7kDa (189aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNKLEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 2mM DTT, 100mM NaCl, 0.1mM PMSF
Other Names PDGFA associated protein 1, HASPP28, PAP, PAP1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap