PCNP, 1-178aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
PCNP (PEST proteolytic signal containing nuclear protein) is a nuclear protein implied to play a role in cell cycle regulation and tumorigenesis. This protein is ubiquitinated post-translationally by NIRF, an ubiquitin ligase. PCNP exsists as three isoforms produced by alternative splicing events and may be involved in cell cycle regulation. Recombinant human PCNP protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03309
Size 100ug
Host E.coli
Accession
Molecular Weight 21.5 kDa (202aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMADGKAGDEKPEKSQRAGAAGGPEEEAEKPVKTKTVSSSNGGESSSRSAEKRSAEEEAADLPTKPTKISKFGFAIGSQTTKKASAISIKLGSSKPKETVPTLAPKTLSVAAAFNEDEDSEPEEMPPEAKMRMKNIGRDTPTSAGPNSFNKGKHGFSDNQKLWERNIKSHLGNVHDQDN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol.
Other Names PEST proteolytic signal containing nuclear protein, DKFZp781I24156.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap