Home / Products / proteins / PCNA, 1-261 aa, Human, Recombinant, E.coli

PCNA, 1-261 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
PCNA (Proliferating Cell Nuclear Antigen) is found in the nucleus and is a cofactor of DNA polymerase delta. This protein is associated with DNA synthesis and repair. The encoded protein acts as a homotrimer and helps increase the processivity of leading strand synthesis during DNA replication. It appears during late G1- phase, S-phase of mitosis and persists until the end of the M-phase because of its long biological half-life.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03308
Size 100 µg
Host E.coli
Accession
Molecular Weight 28 kDa (261 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MFEARLVQGSILKKVLEALKDLINEACWDISSSGVNLQSMDSSHVSLVQLTLRSEGFDTYRCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMDLDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNIKLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 2 mM EDTA 20% glycerol
Other Names Proliferating cell nuclear antigen.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap