Home / Products / proteins / Parathyroid Hormone Recombinant, E.coli

Parathyroid Hormone Recombinant, E.coli

Categories: [Proteins / Peptides]
Human parathyroid hormone(hPTH) is an 84 amino acid residue peptide and one of the main regulators in maintenance of calcium homeostasis. It acts primarily on kidney and bone cells stimulating calcium back resorption or calcium mobilization, respectively. The whole mechanism is still under discussion, but low-dose hPTH triggers cyclic AMP-dependent protein kinase in some populations of bone cells bearing PTH receptors, which stimulates the proliferation of osteoblasts.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03290
Size 100 µg
Host E.coli
Accession
Molecular Weight 9.55 kDa (85 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In phosphate-buffered Saline(pH 7.4) containing 2 mM EDTA.
Other Names PTH, PTH1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap