Home / Products / proteins / OVCA2, 1-227aa, Human, His tag, E.coli

OVCA2, 1-227aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ovarian tumor suppressor candidate 2, also known as OVCA2, belongs to the UPF0483 family. It is ubiquitously expressed and its expression is regulated by retinoids. OVCA2 interacts with apoptosis-related protein Bag-1, indicating that this protein may participate in cell proliferation. Due to its structural and catalytic characteristics, OVCA2 is thought to act as a serine-hydrolase and, because of its reduced expression in ovarian and other tumor cell lines, it may play a role in tumor suppression.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03272
Size 10 µg
Host E.coli
Accession
Molecular Weight 26.9kDa (251aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAAQRPLRVLCLAGFRQSERGFREKTGALRKALRGRAELVCLSGPHPVPDPPGPEGARSDFGSCPPEEQPRGWWFSEQEADVFSALEEPAVCRGLEESLGMVAQALNRLGPFDGLLGFSQGAALAALVCALGQAGDPRFPLPRFILLVSGFCPRGIGFKESILQRPLSLPSLHVFGDTDKVIPSQESVQLASQFPGAITLTHSGGHFIPAAAPQRQAYLKFLDQFAE
Purity > 95% by HPLC
Concentration > 90% by SDS - PAGE
Formulation 26.9kDa (251aa), confirmed by MALDI-TOF
Other Names Ovarian tumor suppressor candidate 2, Ovarian cancer-associated gene 2 protein.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap