Home / Products / proteins / OSTN, 28-133aa, Human, His tag, E.coli

OSTN, 28-133aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Osteocrin (OSTN), also known as Musclin, contains two conserved sequence motifs homologous to the natriuretic peptide family. This protein appears to modulate osteoblastic differentiation and highly expressed in cells of osteoblast lineage and in skeletal muscle tissue. It could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03267
Size 10 µg
Host E.coli
Accession
Molecular Weight 14.0kDa (127aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSATDLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSRG
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by BCA)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 200mM NaCl
Other Names Osteocrin, Musclin.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap