Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP03265 |
Size | 30 µg |
Host | |
Accession | |
Molecular Weight | 44.7 kDa (389 aa) (On SDS-PAGE under denatured condition, apparent molecular weight of glycosylated rhOPG protein will appear at approximately 55kDa) |
AP_Mol_Weight | |
Tag | |
Sequences | ADPETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCLHHHHHH |
Purity | > 95% by HPLC |
Concentration | 0.5 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In PBS (pH 7.4) containing 10% glycerol |
Other Names | Tumor necrosis factor receptor superfamily, member 11b, Osteoclastogenesis inhibitory factor, OPG, OCIF |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap