Osteoprotegerin/TNFRSF11B, 22-401aa, Human, His-tagged, Recombinant, Hi-5 Cell

Categories: [Proteins / Peptides]
Osteoprtegerin (OPG) is a member of the tumor necrosis factor (TNF)-related family, is referred to as TNFRSF11B and part of the OPG/receptor activator of NF-кB ligand (RANKL)/receptor activator of NF-кB (RANK) triad. This cytokine that lacks any apparent cell-association motifs and exists as a soluble secreted protein, network regulates the differentiation and activation of osteoclasts and hence the critical balance between bone formation (osteoblasts) and bone resorption (osteoclasts).
List Price: $402
  • Buy 5 for $381.9 each and save 5%
  • Buy 21 for $361.8 each and save 10%
  • Buy 31 for $341.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03265
Size 30 µg
Host
Accession
Molecular Weight 44.7 kDa (389 aa) (On SDS-PAGE under denatured condition, apparent molecular weight of glycosylated rhOPG protein will appear at approximately 55kDa)
AP_Mol_Weight
Tag
Sequences ADPETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCLHHHHHH
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In PBS (pH 7.4) containing 10% glycerol
Other Names Tumor necrosis factor receptor superfamily, member 11b, Osteoclastogenesis inhibitory factor, OPG, OCIF
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap