ORM, 19-201aa, Human, E.coli

Categories: [Proteins / Peptides]
Orosomucoid 1, also known as ORM1, is an acute phase plasma protein synthesized by the liver. The protein is believed to regulate the interaction between blood cells and endothelial cells, and together with haptoglobin and C reactive protein, also regulates the extravasation of the cells during infection and inflammation. Expression of ORM1 is induced by acute-phase stimulatory agents such as bacterial lipopolysaccharides.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03257
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.7 kDa (184aa)
AP_Mol_Weight
Tag
Sequences MQIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 5% glycerol
Other Names Alpha-1-acid glycoprotein 1, Orosomucoid-1, ORM, AGP1, AGP-A
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap