OMP, 1-163aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Olfactory marker protein, also known as OMP, is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. It is expressed in the cytoplasm of olfactory chemosensory neurons in the nasal neuroepithelium. OMP expression is a sign of mature vertebrate olfactory receptor neurons (ORNs). OMP may have a modulatory role in the odor detection/signal transduction cascade. In fetal olfactory epithelial cells, OMP is also a potent enhancer of mitosis, and it promotes an increase in uptake of tritiated thymidine in liver. Recombinant human OMP protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03253
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.3 kDa (186aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAEDRPQQPQLDMPLVLDQGLTRQMRLRVESLKQRGEKRQDGEKLLQPAESVYRLNFTQQQRLQFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by BCA assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol, 1mM DTT
Other Names Olfactory marker protein , olfactory neuronal-specific protein
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap