OLR1, 58-273aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
OLR1, as known as oxidized low-density lipoprotein receptor 1, is a type 2 transmembrane receptor belonging to the C-type lectin family. It belongs to the functionally defined scavenger receptor (SR) superfamily. This protein is the first member of the class E scavenger receptor subfamily. Also, this protein may play a role in the progression of vulnerable carotid plaque and might regulate vulnerable plaque formation in cooperation with MMPs and TIMP2. Recombinant human OLR1, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03251
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 25.8kDa (225aa), 28-40kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPMQLSQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQHHHHHH
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Oxidized low-density lipoprotein receptor 1 isoform 1, OLR1, CLEC8A, LOX1, hLOX-1, LOXIN, SCARE1, SLOX1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap