Home / Products / proteins / OAS1, 1-364 aa, Human, His-tagged, Recombinant, E.coli

OAS1, 1-364 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
OAS1 is an enzyme included in the 2’,5’-oligoadenylate synthase family. This enzyme is induced by interferons and uses adenosine triphosphate in 2’-specific nucleotidyl transfer reactions to synthesize 2’,5’- oligoadenylates(2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication.
List Price: $731
  • Buy 5 for $694.45 each and save 5%
  • Buy 21 for $657.9 each and save 10%
  • Buy 31 for $621.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03239
Size 100 µg
Host E.coli
Accession
Molecular Weight 43.9 kDa (384aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol and 1mM DTT.
Other Names 2’,5’-oligoadenylate synthetase 1, isoform2, IFI-4, OIAS, OIASI.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap