Home / Products / proteins / NXT2, 1-197aa, Human, His tag, E.coli

NXT2, 1-197aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NXT2 (nuclear transport factor 2-like export factor 2) is a member of NXT family proteins that are generally involved in exporting nuclear RNA in eukaryotic cells. This protein is regulator of protein export for NEScontaining proteins. Also, it associates with NXF1, NXF2, NXF3 and NXF5 and plays a role in mRNA nuclear export. NXT2 has a critical role in maintaining morphogenetic integrity of embryonic heart in vertebrate species.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03238
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.3kDa (221aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMRKYRSHWSQGDREGYQRRSNYYEGPHTSHSSPADRTREEVVTPTLPEHTATRSQMATSLDFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNAVSGLDALNNFFDTLPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAQSTPNNTVWKIASDCFRFQDWSSS
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 40% glycerol, 200mM NaCl
Other Names NTF2-related export protein 2, P15-2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap