NXPH1, 22-271aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
NXPH1, also known as Neurexophilin-1, is one of at least four vertebrate neuropeptide-like secreted glycoproteins in the neurexophilin family. It encodes a secreted protein with a variable N-terminal domain, a highly conserved, N-glycosylated central domain, a short linker region, and a cysteine-rich C-terminal domain. This protein forms a very tight complex with alpha neurexins, a group of proteins that promote adhesion between dendrites and axons. Genetic deletion of NXPH1 and/or NXPH-3 produces no anatomical effect, although mice lacking NXPH-3 show defects in motor coordination. Recombinant human NXPH1 protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $402
  • Buy 5 for $381.9 each and save 5%
  • Buy 21 for $361.8 each and save 10%
  • Buy 31 for $341.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03236
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 29.7kDa (259aa) 28-40KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPANLTNGGKSELLKSGSSKSTLKHIWTESSKDLSISRLLSQTFRGKENDTDLDLRYDTPEPYSEQDLWDWLRNSTDLQEPRPRAKRRPIVKTGKFKKMFGWGDFHSNIKTVKLNLLITGKIVDHGNGTFSVYFRHNSTGQGNVSVSLVPPTKIVEFDLAQQTVIDAKDSKSFNCRIEYEKVDKATKNTLCNYDPSKTCYQEQTQSHVSWLCSKPFKVICIYISFYSTDYKLVQKVCPDYNYHSDTPYFPSGHHHHHH
Purity > 95% by HPLC
Concentration 17 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Neurexophilin-1, NXPH1, Nbla00697, NPH1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap