Home / Products / proteins / NUDT3, 1-172aa, Human, His tag, E.coli

NUDT3, 1-172aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NUDT3, also known as DIPP, DIPP1 (diphosphoinositol polyphosphate phosphohydrolase 1), is a 172 amino acid cytoplasmic protein belonging to the nudix hydrolase family and DIPP subfamily. NUDT3 acts as a negative regulator of the ERK 1/2 pathway and hydrolyzes 5-phosphoribose 1-diphosphate. NUDT3 exists as a monomer and binds magnesium as a cofactor.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03229
Size 50 µg
Host E.coli
Accession
Molecular Weight 21.6 kDa (192aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMMKLKSNQTRTYDGDGYKKRAACLCFRSESEEEVLLVSSSRHPDRWIVPGGGMEPEEEPSVAAVREVCEEAGVKGTLGRLVGIFENQERKHRTYVYVLIVTEVLEDWEDSVNIGRKREWFKIEDAIKVLQYHKPVQASYFETLRQGYSANNGTPVVATTYSVSAQSSMSGIR
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl,5mM DTT, 20% glycerol
Other Names Nudix (nucleoside diphosphate linked moiety X)-type motif 3, DIPP, DIPP1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap