Home / Products / proteins / NUDT21, 1-227aa, Human, His tag, E.coli

NUDT21, 1-227aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NUDT21, also known as CPSF5 or CFIm25, is a member of the Nudix hydrolase family of pyrophosphatases. This protein localizes to the paraspeckles and forms a heterodimer with CPSF6 or CPSF7 to comprise the CFIm (mammalian cleavage factor I) complex. NUDT21 is the smaller subunit of the complex and is present in all heterodimer combinations. NUDT21 plays an important role in pre-mRNA 3' cleavage and polyadenylation processing.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03228
Size 100 µg
Host E.coli
Accession
Molecular Weight 28.3 kDa (247aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl,2mM DTT, 20% glycerol
Other Names Nudix (nucleoside diphosphate linked moiety X)-type motif 21, CFIM25, CPSF5, DKFZp686H1588
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap