Home / Products / proteins / NUDT2, 1-147aa, Human, His tag, E.coli

NUDT2, 1-147aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NUDT2 is a member of the MutT family of nucleotide pyrophosphatases, a subset of the larger NUDIX hydrolase family. This protein maintains homeostasis by using water to cleave the metabolite NUDT symmetrically back into its original ATP and AMP molecules. NUDT2 is also active towards other adenosine and diadenosine polyphosphates with four or more phosphate groups, but not towards diadenosine triphosphate.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03227
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.0 kDa (167aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay )
Formulation Liquid. In 20mM Tris buffer(pH 8.0) containing 10% glycerol, 1mM DTT, 0.1M NaCl.
Other Names bis(5'-nucleosyl)-tetraphosphatase [asymmetrical].APAH1, MGC10404.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap