NUBP1, 1-320aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
NuBP1 also known as cytosolic Fe-S cluster assembly factor NuBP1 isoform 1. NuBP1 is implicated in the regulation of centrosome duplication by similarity. This protein is component of the cytosolic iron-sulfur (Fe/S) protein assembly (CIA) machinery. It required for maturation of extra mitochondrial Fe-S proteins The NuBP1-NuBP2 heterotetramer forms a Fe-S scaffold complex, mediating the de novo assembly of a Fe-S cluster and its transfer to target apoproteins. Recombinant human NuBP1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03217
Size 100 µg
Host E.coli
Accession
Molecular Weight 36.9kDa (343aa) confirmed by MALDI-TOF.
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid, In Phosphate buffered saline (pH7.4) containing 10% glycerol, 1mM DTT
Other Names Cytosolic Fe-S cluster assembly factor NuBP1 isoform 1, NBP, NBP1, NBP35
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap