NTF4, 81-210aa, Human, E.coli

Categories: [Proteins / Peptides]
NTF4, also known as neurotrophin 4, is a member of a family of neurotrophic factors neurotrophins that control survival and differentiation of mammalian neurons. This protein is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brainderivedneurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF4-deficient mice only show minor cellular deficits and develop normally to adulthood.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP03212
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.1 kDa (131aa)
AP_Mol_Weight
Tag
Sequences MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRHWVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGRA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 20% glycerol
Other Names Neurotrophin-4, NT4, NT5, NTF5, NT-4/5.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap